PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100061930041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family BES1
Protein Properties Length: 303aa    MW: 32483.1 Da    PI: 9.5283
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100061930041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822156.51.9e-483914324129
                        DUF822  24 aiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssala 104
                                   aiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+v++DGttyrkg+kp   +e++g+sa+++p ss + s+ ss++a
  Ote100061930041|100061930041  39 AIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVQPDGTTYRKGYKPC-PMEIGGTSANITPGSSRNPSPPSSYFA 118
                                   9****************************************************.*************************** PP

                        DUF822 105 spvesysaspksssfpspssldsis 129
                                   sp++sy++sp+sssfpsps+ + + 
  Ote100061930041|100061930041 119 SPIPSYQPSPQSSSFPSPSRHNPNA 143
                                   *******************987764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056879.5E-4639140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MMWGSSSAAG GDGSGGDARR KPSXXXXXXX XXXXXXXXAI AAKIYAGLRA QGNYNLPKHC  60
DNNEVLKALC AEAGWIVQPD GTTYRKGYKP CPMEIGGTSA NITPGSSRNP SPPSSYFASP  120
IPSYQPSPQS SSFPSPSRHN PNASFAFLLS SIPSSLPPLR ISSSAPVTPP SSSPKRLPKQ  180
TXXXXXXXXX XXXXXXIAKE SISALNVPFY AASAPASPIR GQRQWVNFQA YANAPNVAPT  240
SPTFNLVRPN AEVIPLKDAV MSDKGKAVEF DFEGMAVKPW EGERIHEVGM DDLELTLGNA  300
RSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083731.11e-119PREDICTED: protein BRASSINAZOLE-RESISTANT 1
SwissprotQ8S3071e-88BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-108A0A068UH77_COFCA; Uncharacterized protein
STRINGSolyc04g079980.2.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454